- CMC2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85289
- Human
- CMC2
- 2310061C15Rik, C16orf61, DC13
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: MHPDLSPHLH TEECNVLINL LKECHKNHNI LKFFGYCNDV DRELRKCLKN EYVENRTKSR EHGIAMRKKL
- Unconjugated
- Rabbit
- Immunohistochemistry, Immunohistochemistry-Paraffin
- C-X9-C motif containing 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKL
Specifications/Features
Available conjugates: Unconjugated